PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_025363-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 510aa    MW: 55893.1 Da    PI: 6.5228
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_025363-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-1660104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT+eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
    NNU_025363-RA  60 RERWTEEEHKKFLEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 104
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-1654108IPR009057Homeodomain-like
PROSITE profilePS5129421.47655109IPR017930Myb domain
TIGRFAMsTIGR015576.1E-1758107IPR006447Myb domain, plants
SMARTSM007172.5E-1359107IPR001005SANT/Myb domain
PfamPF002496.1E-1460103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-960100IPR009057Homeodomain-like
CDDcd001671.71E-1062105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MTVQDNSGCS TSNTIAMARS QTCLDVGAQS LNGVQLKEIY SCGDEFPPKV RKPYTITKQR  60
ERWTEEEHKK FLEALKLYGR AWRRIEEHVG TKTAVQIRSH AQKFFSKVVR ESTGSNASSV  120
KPIEIPPPRP KRKPMHPYPR KLVHSLQKGI SVPEQPERSR SPNLSTSEAN QSPKSVLSTV  180
VSDTIGSVAS NPHNDSPSPV SSAADANPGS LVLAEQENGN LPSTSSVEED SGYPSSVPVT  240
ATSSPQDQSS TKVDWGSKDN ACDKEGATSE ASMISLKLFG RTVLVTDSNR PSSSNLGSRK  300
SPPSESCKDS DKNDEKPGKT PQQNSTQINF SMEASRSAWS PWPCGAPPMF YCMPFQKEDP  360
NLVEATSSTL PWWALYGGLP YPVMPSFNLN SIQTYPDTCL EETSKKDINR EESRTGSNTS  420
STNDAGVGEK NEDVVDFQNQ EPSSEDVEKE PASVFLLKPS ETSAFSVLKP IPNKCTKGFV  480
PYKRCLTERD AQSSGIIGEE RETQRIRLCL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3821521e-46FQ382152.1 Vitis vinifera clone SS0ABG69YH11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246196.10.0PREDICTED: protein REVEILLE 1-like
SwissprotF4KGY63e-59RVE1_ARATH; Protein REVEILLE 1
TrEMBLA5C7G81e-156A5C7G8_VITVI; Putative uncharacterized protein
STRINGVIT_04s0079g00410.t011e-154(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.12e-46MYB_related family protein